PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G11850.1
Common NameLOC102716221
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family BBR-BPC
Protein Properties Length: 330aa    MW: 36610.2 Da    PI: 10.0779
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G11850.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind404.41.4e-12313301301
     GAGA_bind   1 mdddgsre..rnkg.yye.........paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllall 85 
                   md+ g+re  r+++ +y+         ++++lk++++++l++++++rd++irer++al+ekkaa+aerdmaf+qrd+a+aern+a+verdn+l+al+
  OB06G11850.1   1 MDNLGHREngRQRPdQYKglhtqwmmpQQRHLKDHQSMNLLALMNDRDNAIRERDHALAEKKAAIAERDMAFAQRDAAMAERNAAVVERDNALAALE 97 
                   9999*99999****9**********96669******************************************************************9 PP

     GAGA_bind  86 lvensla...salpvgvqvlsgtksidslqqlse.....pqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkak..kkkkks 171
                   l++++     + +++ +++l+g+k+i++++qls+      ql+ds+++ +re++++ea+pi++a+ ++ ++k++kk++++++p+++ +   +k+kk+
  OB06G11850.1  98 LARTNGLnmnNGNGFPQGSLNGSKNIHHHDQLSHaqsspLQLADSPYDhAREMHISEAYPISTAPGSVGKAKRSKKNNSQASPLKRPSGvlRKTKKP 194
                   9888765566889999***************888899999********9*************************************99988888889 PP

     GAGA_bind 172 ekskkkvkkesader......skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSq 262
                   + ++k+v +++  ++      +k+e+k++dl+ln+v++Dest+P+P+CsCtG+lrqCYkWGnGGWqS+CCt++iS+yPLPv +++r+aR++grKmS+
  OB06G11850.1 195 SGDWKNVGMSGYGDDsahasvMKNEWKDQDLGLNQVAFDESTMPAPACSCTGKLRQCYKWGNGGWQSSCCTMNISMYPLPVIPNKRHARMGGRKMSG 291
                   *********998744588999**************************************************************************** PP

     GAGA_bind 263 gafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                   gaf+klL++LaaeG+dls+pvDLkdhWAkHGtn+++tir
  OB06G11850.1 292 GAFTKLLSRLAAEGHDLSTPVDLKDHWAKHGTNRYITIR 330
                   **************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062174.0E-981330IPR010409GAGA-binding transcriptional activator
SMARTSM012265.3E-1781330IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MDNLGHRENG RQRPDQYKGL HTQWMMPQQR HLKDHQSMNL LALMNDRDNA IRERDHALAE  60
KKAAIAERDM AFAQRDAAMA ERNAAVVERD NALAALELAR TNGLNMNNGN GFPQGSLNGS  120
KNIHHHDQLS HAQSSPLQLA DSPYDHAREM HISEAYPIST APGSVGKAKR SKKNNSQASP  180
LKRPSGVLRK TKKPSGDWKN VGMSGYGDDS AHASVMKNEW KDQDLGLNQV AFDESTMPAP  240
ACSCTGKLRQ CYKWGNGGWQ SSCCTMNISM YPLPVIPNKR HARMGGRKMS GGAFTKLLSR  300
LAAEGHDLST PVDLKDHWAK HGTNRYITIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0706160.0AK070616.1 Oryza sativa Japonica Group cDNA clone:J023060O20, full insert sequence.
GenBankAY9575050.0AY957505.1 Oryza sativa (japonica cultivar-group) barley B recombinant-like protein D mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655749.10.0PREDICTED: barley B recombinant-like protein D
RefseqXP_015693740.10.0PREDICTED: barley B recombinant-like protein D
SwissprotQ5VSA80.0BBRD_ORYSJ; Barley B recombinant-like protein D
TrEMBLJ3MAZ10.0J3MAZ1_ORYBR; Uncharacterized protein
STRINGOB06G11850.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62263756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-103basic pentacysteine 6